Check out HYIPs with HYIP.biz
Reviews+27 | Payouts+49 |  Blacklist+3 |  All Monitors |  FF add-on |  Widgets |  Advertising |  Add Project |  Contact Us
Server Time: 14 May 2024 18:23:11
Last Update: 14 May 2024 18:00:03
 
Join with: 
 
Tradingsolve Ltd
0.0
Tradingsolve Ltd
+
Added: Feb 29,2024 07:39
Closed: Mar 05,2024 [5 days]
Payment systems:
Not Paying1
Plans: 1% Daily for 24 hours 30% weekly Profit until 1050% profit
Min deposit: $5
Max deposit: $1000000
Referral: 10%
249 views [19 clicks] Reviews: 000
Forum(s): HE
Telegram(s): @tradingsolveteam
Domain: tradingsolve.com is registered for a 2 years by NameCheap, Inc.
[from Aug 20,2023 to Aug 20,2024]
+
ssl SSL valid for a 12 months - Sectigo Limited
+
Shared Hosting  Cheap price hosting - 262 domains hosted on IP: 162.0.229.125
-
Hosting: Namecheap, Inc. [ namecheaphosting.com ] -
IP: 162.0.229.125 [used in: 2 projects]
Network: 162.0.x.x [638 projects] Canada
-
Found similar content [text: 32 projects]
-

Latest Reviews
Be first to add a vote/review and share your statement about "tradingsolve.com"
Join using Google, Telegram, Facebook, Twitter account or e-mail!

All Monitors
# Monitor #Pos. Status
Updated
Invested ROI(%)
USD
Last Payout Latest Event Added
+ HYIPexplorer 41
not paid
03 May 2024
$1000 6%
60 USD
04 Mar 2024
2 months ago
problem » not paid
3 weeks ago
29 Feb 2024
2 months ago

Content
#Tags

Here's what it says on the tradingsolve.com website:

Welcome to Tradingsolve LTD where innovation meets investment. We are a leading AI trading robot company dedicated to delivering consistent profits to our members. Our AI Trading Robots Our cutting-edge AI trading robots harness the power of artificial intelligence and data analytics to navigate the complexities of the financial markets. These intelligent algorithms continuously analyze market trends, news, and historical data, making split-second decisions to optimize trading strategies. Guaranteed Results .At TradingSolve LTD we believe in transparency and accountability. Our commitment to our members is simple: guaranteed results. We employ a rigorous risk management approach to ensure the safety of your investments while striving for consistent profits. With us, you can trust in a reliable and secure path to financial growth. Join us today and become a part of our thriving community of successful investors. Your financial future is our priority. What is the tradingsolve.com platform is secure. TRADINGSOLVE LTD is a legally registered company head quartered in London, UK, backed by a team of experts in finance and cryptocurrency trading. We boast a track record of successful deals and a vast base of satisfied users who have reaped significant daily returns via our platform. In terms of security, we utilize cutting-edge technology and practices to protect our users' personal and financial information. We also regularly update our security measures to stay ahead of potential risks. Which payment methods does tradingsolve. Additionally, credit/debit cards, bank transfers, or cryptocurrencies. All our transactions are processed in USD, with cryptocurrency values being converted based on the prevailing exchange rate during deposits or withdrawals. Of course! You can reinvest your profits to bypass additional transfer fees. Simply head to the "Initiate Deposit" section and select your account balance as the payment source. The system will then use your balance to create a fresh deposit. What's the minimum and Maximum amount I can withdraw from tradingsolve. This means the processing time can vary from a few minutes to a maximum of 24 hours. This timeframe is for daily profits and referral commissions. For withdrawals post the end of a deposit plan, the processing might take up to 24 hours. Please understand that we don't control the confirmation time on specific cryptocurrency blockchains. This time is separate from our processing duration. We also can't influence third-party wallets that update balances after certain confirmations. For any queries or concerns about withdrawals or confirmations, our customer support is always ready to assist. Can I have more than one account on tradingsolve.com However, each account should have a distinct username and email. Please note that creating multiple accounts to act as your own referrals is against our policies. Exploiting the referral system for commissions from your deposits is strictly prohibited. At TRADINGSOLVE LTD, we prioritize your account's security. We suggest setting a strong password with a mix of characters, numbers, and symbols. Never share your credentials and use a unique password, different from your email. We highly recommend enabling 2 Factor Authentication for added security. Beware of potential scammers impersonating our staff. Our support will never ask for deposits to external wallets. Always transact ONLY through our official website, https://tradingsolve.com. Ensure you're using the official links provided on our site. All operations are strictly between you and TRADINGSOLVE LTD. We use a highly secure server for data storage, protected against potential threats. Our website has an SSL SHA-256 connection with RSA Encryption for enhanced security. Your cryptocurrency funds are stored in secure wallets, inaccessible to outsiders. Our expert team strictly adheres to all security protocols and confidentiality guidelines. Decision Making: Based on this data analysis, our AI trading robots make rapid, data-driven decisions regarding buying and selling assets. These decisions are driven by precise calculations and risk assessments. Profit Sharing: As profits are generated, we distribute them among our members who have invested with us. Your earnings are a direct reflection of the successful trading strategies employed by our AI system. Continuous Improvement: We are committed to ongoing research and development, constantly enhancing our AI algorithms to adapt to evolving market conditions.
Tradingsolve Ltdintelligent algorithms continuously analyze market trendsleading ai trading robot company dedicated% daily profit ai trading pro making5% daily profit ai trading gold making5% weekly profit ai tesla trading makinglegally registered company head quarteredai trading robots make rapidedge ai trading robots harnessai trading robot makingreaped significant daily returnsbypass additional transfer feesrigorous risk management approachsuccessful trading strategies employedensuring precise trading decisionsexpert team strictly adheresai trading robotsoptimize trading strategiesevolving market conditionsdecision making: basedadvanced trading technologyinnovation meets investmentprevailing exchange ratehighly recommend enablingcredit/debit cardsofficial links providedpotential scammers impersonatingai tradingspecific cryptocurrency blockchainsai algorithmscreating multiple accountsproven track recordsimple: guaranteed resultshighly secure server% weekly  profit delivering consistent profitsmanually process withdrawalssupport multiple cryptocurrenciesmaking splitcryptocurrency tradingdaily profitsedge technologyguaranteed profit:ai systemprofit sharing:simply headmultiple accountsprecise calculationstrack recordrisk assessmentsguaranteed resultssuccessful investorssuccessful dealsconverted basedpotential threatspotential risksstrictly prohibitedcryptocurrency valuescryptocurrency walletsconsistent profitsbank transferscontinuous improvement:stay aheaddirect reflectionunique passwordwise money  constantly enhancingregularly updatefactor authenticationbsc bepshared externallypayment sourcecustomer supportupdate balancesparty walletsstrong passworddistinct usernameconfidentiality guidelinesselling assetsongoing researchexternal walletssuggest settingssl shafresh depositofficial websitedeposit planrsa encryptionfinancial informationinitiate depositartificial intelligencecompelling reasonsfinancial growthvast basefinancial marketsfinancial futurethriving communitydata storagedata analyticshistorical datadata analysiswithdrawals postcryptocurrency fundssecure pathsecure walletsprocessing durationreferral systemconfirmation timeprofitsecurity measuresadded securityenhanced securitymaximum amountdriven decisionsreferral commissionsutilize cuttingpersonal detailsprocessing timesatisfied userssecurity protocolshttps://tradingsolveaccount balanceteamstrictlydecisionsprocesssupportcryptocurrenciesprofitsdatawithdrawalstimesystemprocessingsecuresecuritydrivenfundspersonalmaximumbalancecommissionswebsitecuttingprotocolsusersaccounttradingsolve

Domain Information
#Whois
Host : tradingsolve.com
Registrar : NameCheap, Inc.

Nameservers :
dns1.namecheaphosting.com (156.154.132.200)
dns2.namecheaphosting.com (156.154.133.200)

Created :2023-08-20
Expires :2024-08-20
Updated :2023-08-22

Monitoring
New HYIP Bitaveo.com
Invested: $200
paying
New HYIP Cfg Liberty
Invested: $150
paying
New HYIP Uctraders Limited
Invested: $100
paying
New HYIP Bitcoin Wealth
Invested: $100
paying
New HYIP Bitcobid Limited
Invested: $100
paying
New HYIP Luxio Profit Limited
Invested: $100
paying
New HYIPs
New HYIP Varai.net
27 minutes ago
0.4
New HYIP Nanotrade
5 hours ago
0.1
New HYIP C12v2.net
20 hours ago
4.4
New HYIP Mavatars
1 day ago
0.2
New HYIP Speed-Gold
1 day ago
0.1
New HYIP Fast-Oil
1 day ago
0.1
New HYIP Longtradegroup
1 day ago
0.2
Latest Events
Recent event
Varai.net
Instantmonitor 27 minutes ago
added | waiting
Recent event
Nanotrade
Bakster 27 minutes ago
added | paying
Recent event
Goldenprice.biz
List4hyip 2 hours ago
added | paying
Recent event
7 Days Capital
Instantmonitor 3 hours ago
changed | paying » waiting
Recent event
Earnten
Instantmonitor 3 hours ago
changed | paying » waiting
Recent event
Goldenprice.biz
Investracing 4 hours ago
changed | not paid » paying
Recent event
Xtwelve.ai
Fairmonitor 5 hours ago
added | waiting
Problematic HYIP & Scam
Stellary.hk
Closed: 13 hours ago
Vip Gold
Closed: 13 hours ago
Best-Trade
Closed: 13 hours ago
Oneday.investments
Closed: 1 day ago
Muxenday
Closed: 12 May 2024
Tokentrax.vip
Closed: 12 May 2024
Nutronx.org
Closed: 11 May 2024
Partners
DISCLAIMER: Please note that we do not promote or recommend any programs/projects/games listed here. Your use of this web site is at your own risk. The materials presented on this site may not reflect the most current legal developments, verdicts or settlements, or the correct law of the jurisdiction in which you reside. All information available on or accessed through this site, is provided "as is." These materials may be changed, improved, or updated without notice.
What is HYIP? | Privacy Policy | Terms of Use | About | Send Feedback